PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_09144A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 276aa    MW: 30032.1 Da    PI: 10.5551
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_09144AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-161964147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               rg W + Ed++l+++v ++G+ +W++Ia+++  gR++k+c++rw++ 
  Oropetium_20150105_09144A 19 RGHWRPGEDQKLKELVDKYGPQNWNSIAEKLE-GRSGKSCRLRWFNQ 64
                               899*****************************.***********996 PP

2Myb_DNA-binding61.61.7e-1972115247
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                 ++T+eE+e+l+ a++ +G++ W++Iar+++ gRt++ +k++w+ +
  Oropetium_20150105_09144A  72 RPFTEEEEERLLAAHRVHGNK-WALIARHFP-GRTDNAVKNHWHVV 115
                                69*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.7861465IPR017930Myb domain
SuperFamilySSF466897.11E-3017112IPR009057Homeodomain-like
SMARTSM007171.5E-131867IPR001005SANT/Myb domain
PfamPF002492.3E-161964IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-262072IPR009057Homeodomain-like
CDDcd001671.61E-132263No hitNo description
PROSITE profilePS5129428.60166120IPR017930Myb domain
SMARTSM007175.9E-1770118IPR001005SANT/Myb domain
PfamPF002492.3E-1671114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2273118IPR009057Homeodomain-like
CDDcd001671.05E-882116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MASSSTTSDG GAKSSSCPRG HWRPGEDQKL KELVDKYGPQ NWNSIAEKLE GRSGKSCRLR  60
WFNQLDPRIN KRPFTEEEEE RLLAAHRVHG NKWALIARHF PGRTDNAVKN HWHVVMARRS  120
RERSRLLARA AHSPSSXXXX XXXXXXXXXS FCFGFSSKTS SIGSSGGMFG SSPAANRSTP  180
FFRSYGGTSG RGTGATFEAA GRYSYGGGNK QQAAPPLSIT FSSPKDALAM DLGHGLHASN  240
DVSKRDQYNV DAGDETPSTR KGVPFFDFLG VGVSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32191197107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0928531e-110FP092853.1 Phyllostachys edulis cDNA clone: bphyem102e11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001169060.11e-108uncharacterized protein LOC100382901
TrEMBLC0PBK61e-108C0PBK6_MAIZE; Uncharacterized protein
STRINGSi026751m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.13e-57myb domain protein 54